PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00153g01211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 474aa    MW: 54268.5 Da    PI: 6.5141
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00153g01211.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like64.22.4e-20169219455
                   G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                rWt eLH++F+e+++qL G+ +  Pk+ilelm+v+gLt+ +v+SHLQk R 
  Peaxi162Scf00153g01211.1 169 TRWTVELHAKFMEVMRQL-GEGRCYPKEILELMNVPGLTRMQVASHLQKCRN 219
                               69****************.9*****************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.981163222IPR017930Myb domain
SuperFamilySSF466899.14E-15165219IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-20166219IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17169220IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MLSKGKKRFD IMIVNVHSPN LMSFQLLAQA VALDIVSICK RALDIGAYLY LKKPLHEEFV  60
KYMWQFVLRE RFKKEKEREE RTDEMKIIDD GRNNIVCDEQ VGVKIIPNNN ENDHDESDNH  120
TEVENNNINV ASKEKYTVKR SKRGRKRTKI TEVEPDSESI GGPRRKVCTR WTVELHAKFM  180
EVMRQLGEGR CYPKEILELM NVPGLTRMQV ASHLQKCRNN NWRVPEARKI HHSNGQGSSS  240
GSQQRVFRKK FGSMPHLETN FGQQHHQQPN QDQSQRVPLP PEFVFPSPNN NNTFARGESS  300
TEQQVYRPQL VLVEPHYVNI GNSVNNPFLS HINVGGLQQH AGGPYGMVGL GQGGPVIDES  360
IVYTPSLGDH VHNDYTMKVN IGLETYSGST MISDTNEKEN QQFYGEHNLS DPSMNIVASH  420
ASDSETRSDE RTNFDEYFDF NDVDYLFQNL RPPDNDLPNK QGGSEFDQVY SDDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461121.11e-132PREDICTED: two-component response regulator ORR21-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.16e-22response regulator 2